Hot News

🚨INDEPENDENCE DAY SALE🚨

🎉🎉 40% OFF ALL ITEMS🎉🎉

👌FREE SHIPPING ON ORDERS OVER $100.00👌

😍FREE AIR SHIPPING ON ORDERS OVER $200.00😍

Tirzepatide – Dual GIP/GLP-1 Receptor Agonist

Chemical Identity

Chemical Name: Tirzepatide Acetate
Molecular Formula: C₂₂₇H₃₆₈N₄₈O₆₈
Molecular Weight: ~4813.5 Da
CAS Number: 2023788-19-2
Sequence (Linear): Y-Ahx-HGEGTFTSDLSKQMEEEAVRLFIEWLMNTKRNRNNIA-NH₂ (with fatty acid side chain)
Modifications: C20 fatty diacid moiety via γ-glutamic acid linker at Lys20
Structure Type: Synthetic linear peptide, 39 amino acids

Pharmacological Classification

Tirzepatide is a dual incretin mimetic that acts as a balanced agonist of the glucose-dependent insulinotropic polypeptide (GIP) receptor and a biased agonist of the glucagon-like peptide-1 (GLP-1) receptor, both of which are class B G protein-coupled receptors (GPCRs).

Mechanism of Action

  • GIPR Activation: Enhances insulin secretion and lipogenesis in adipocytes.
  • GLP-1R Activation: Inhibits glucagon, delays gastric emptying, and reduces appetite via CNS.
  • Signaling: Activates cAMP via Gs proteins; exhibits GLP-1R biased agonism favoring cAMP over β-arrestin recruitment.

β-Arrestin Recruitment

Tirzepatide shows functionally selective (biased) agonism at GLP-1R and GIPR:

  • GLP-1R: Compared to native GLP-1, tirzepatide demonstrates significantly reduced β-arrestin recruitment, favoring prolonged cAMP signaling and decreased receptor internalization. This may contribute to sustained therapeutic activity and reduced desensitization.
  • GIPR: Tirzepatide retains strong Gs-coupled cAMP activation with moderate β-arrestin recruitment, aligning closely with endogenous GIP signaling dynamics.

Comparative β-Arrestin Profile

Receptor Native Ligand β-Arrestin Recruitment Tirzepatide Activity
GLP-1R GLP-1 High Low (biased toward cAMP)
GIPR GIP Moderate Similar

References: Lucey M et al., J Biol Chem 2020;295(45):15777–89. Willard FS et al., Cell Reports 2020;33(6):108293.

Molecular Engineering

Fatty acid conjugation increases albumin binding and plasma half-life. Sequence design includes DPP-IV resistance and selective receptor engagement with altered pharmacodynamics.

Pharmacokinetics (Non-Dosing)

  • Elimination: Primarily proteolytic cleavage; renal excretion of fragments.
  • Plasma Protein Binding: ~99%, primarily albumin
  • Half-Life: ~5 days

Biological Effects

Modulates pancreatic hormone secretion, appetite, and adipocyte metabolism. Sustained receptor signaling contributes to glycemic control and weight reduction in preclinical models.

Preclinical Evidence

Demonstrated superior metabolic outcomes compared to GLP-1 monotherapy in db/db and high-fat diet models. Dual receptor activation provides enhanced insulinotropic response and fat mass reduction.

Stability and Storage

  • Form: Lyophilized powder
  • Solubility: Sterile water, acetate buffer, DMSO (analytical prep)
  • Storage: –20°C, protected from light and moisture
  • Reconstitution pH Range: 4.0–6.0 preferred

Comparative Mechanistic Summary

Parameter GIP (native) GLP-1 (native) Tirzepatide
Receptor Affinity High (GIPR) High (GLP-1R) Dual, moderate
β-arrestin Recruitment Moderate High Low (GLP-1R)
Receptor Internalization Yes Rapid Delayed
Half-life Minutes Minutes ~5 days
Albumin Binding None None Strong

References

  1. Yabe D, Seino Y. Prog Biophys Mol Biol. 2011;107(2):248–256.
  2. Lucey M, et al. J Biol Chem. 2020;295(45):15777–15789.
  3. Willard FS, et al. Cell Reports. 2020;33(6):108293.
  4. Coskun T, et al. Diabetes. 2018;67(Suppl 1):64-LB.
  5. Knudsen LB, Lau J. Front Endocrinol. 2019;10:155.
  6. Secher A, et al. Brain Res. 2014;1587:87–93.
  7. Finan B, et al. Cell Metab. 2021;33(1):77–91.
  8. Zhao P, et al. Nat Commun. 2022;13:6921.